PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04068.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 699aa    MW: 75746.4 Da    PI: 6.4156
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04068.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.32e-1610491756
                                    HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                    +lF+++++p++++r eL+k+lgL+ rqVk+WFqNrR+++k
  Zpz_sc04068.1.g00040.1.sm.mkhc 10 RLFKECPHPDEKQRGELSKRLGLDPRQVKFWFQNRRTQMK 49
                                    79***********************************999 PP

2START190.96.3e-602094411206
                                     HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSC.HHHHHHHHHCC CS
                           START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdm.vlallveelld 67 
                                     ela +a++elvk+a+++ep+W +        e +n +e+ ++f++  +     + +ea+r+sg+v+  ++a lve+l+d
  Zpz_sc04068.1.g00040.1.sm.mkhc 209 ELAISAMDELVKMAQVDEPLWLTNMpgapnkETLNFEEYFRSFVPCLGmkpvgFVSEASRESGLVIIdNSAALVETLMD 287
                                     57889*****************999899999999999999999886669999***********997615669******9 PP

                                     CGGCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE.... CS
                           START  68 dkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd.... 131
                                     ++ +W+ ++     ka++le +s+g      g+l lm+aelq+lsplvp R+++f+R+++ql +g w++vdvSvd    
  Zpz_sc04068.1.g00040.1.sm.mkhc 288 KR-RWSDMFScmiaKATILEEVSTGiaggrnGVLLLMKAELQVLSPLVPiREVTFLRFSKQLAEGAWAVVDVSVDgllr 365
                                     99.***********************************************************************84422 PP

                                     .-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                           START 132 .seqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                      +++       +++ v++++lpSg+++++++ng++kvtwveh++++++++h+l+r+l++sgla+ga++w+atlqrqce+
  Zpz_sc04068.1.g00040.1.sm.mkhc 366 dQNS---AttsTAGNVKCRRLPSGCVMQDTPNGYCKVTWVEHTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCEC 441
                                     1233...24569*****************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003898.4E-9555IPR001356Homeobox domain
PROSITE profilePS5007114.544851IPR001356Homeobox domain
SuperFamilySSF466891.17E-13955IPR009057Homeodomain-like
CDDcd000867.77E-14951No hitNo description
Gene3DG3DSA:1.10.10.605.4E-151058IPR009057Homeodomain-like
PfamPF000467.9E-141049IPR001356Homeobox domain
PROSITE patternPS0002702649IPR017970Homeobox, conserved site
PROSITE profilePS5084846.093200444IPR002913START domain
SuperFamilySSF559619.42E-30203441No hitNo description
CDDcd088754.43E-116204440No hitNo description
SMARTSM002343.5E-46209441IPR002913START domain
PfamPF018521.6E-52210441IPR002913START domain
SuperFamilySSF559617.85E-22461680No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MDSCPCCVRR LFKECPHPDE KQRGELSKRL GLDPRQVKFW FQNRRTQMKT QLERHENALL  60
KQENDKLRAE NMTIREAMRS PMCGGCGSPA MLGEVSLEEQ HLRIENARLK DELNRVYSLA  120
TKFLGKPLSF MSGYQMQPHL ALPMPSSSLE LAVGGLGGMG SMPSAAMPGS MGEFTGGVSS  180
PMGTVITPAR AAGAAPPPMV GVDRSILLEL AISAMDELVK MAQVDEPLWL TNMPGAPNKE  240
TLNFEEYFRS FVPCLGMKPV GFVSEASRES GLVIIDNSAA LVETLMDKRR WSDMFSCMIA  300
KATILEEVST GIAGGRNGVL LLMKAELQVL SPLVPIREVT FLRFSKQLAE GAWAVVDVSV  360
DGLLRDQNSA TTSTAGNVKC RRLPSGCVMQ DTPNGYCKVT WVEHTEYDEA SVHQLYRPLL  420
RSGLAFGARR WLATLQRQCE CLAILMSPDT VSANDASVIT QEGKRSMLKL ARRMMENFCA  480
GVSASSAREW SKLDGAAGSI GEDVRVMARK SVNEPGEPPG VVLSAATSVW VPVAPEKLFN  540
FLRNEQLRAE WDILSNGGPM QEMANIAKGQ GPGNSVSLLR ASAMSANQSS MLILQETCTD  600
ASGSMVVYAP VDIPAMQLVM NGGDSTYVAL LPSGFAILPD APGIDSAEHK TGGSLLTVAF  660
QILVNSQPTA KLTVESVETV NNLISCTIKK IKNALQCDT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAPTransfer from AT3G61150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457484.10.0hypothetical protein SORBIDRAFT_03g008090
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLC5XEA60.0C5XEA6_SORBI; Putative uncharacterized protein Sb03g008090
STRINGSb03g008090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1